PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN30839.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 333aa    MW: 37674 Da    PI: 6.1067
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN30839.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W+++++  g+ R+ k+c++rw +yl
       KHN30839.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPSNTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.42.2e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
       KHN30839.1  67 RGNFTDHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.066965IPR017930Myb domain
SuperFamilySSF466892.17E-3011108IPR009057Homeodomain-like
SMARTSM007178.9E-141363IPR001005SANT/Myb domain
PfamPF002494.6E-161461IPR001005SANT/Myb domain
CDDcd001678.33E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.21666116IPR017930Myb domain
SMARTSM007174.0E-1566114IPR001005SANT/Myb domain
PfamPF002498.6E-1467112IPR001005SANT/Myb domain
CDDcd001675.68E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRPPCCDKI GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PSNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKMQ  120
IGGGSDDDNN DDKSNSSNNS QIKGQWERRL QTDIHMAKQA LCEALSLDKP TQIFPETKLP  180
STSSHHHPTT TTTPNQTTSL YASSTENIAR LLENWMKKSP NMATTTTTTM ETKPFSNNNM  240
VITTGSSSSE GTQSTITCTQ EYALDSLWSF NSERSSQSEE NTNLGESKPQ YQEPQETQVP  300
LMLLENWLFD DAAPQCNEDL MNMSLEESTE GLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-25141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU6646450.0KU664645.1 Glycine max cultivar Williams 82 transcription factor MYBJ3 (MYBJ3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003527079.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-120MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0B2RER10.0A0A0B2RER1_GLYSO; Myb-related protein 306
STRINGGLYMA06G20800.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-106myb domain protein 94
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]